- Recombinant Bacillus subtilis TVP38/TMEM64 family membrane protein ytxB (ytxB)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1122602
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 23,331 Da
- E Coli or Yeast
- 1-213
- TVP38/TMEM64 family membrane protein ytxB (ytxB)
Sequence
MKRKTAVKWLAVLAGAGLLYWGNKTYLNVSPKEIRVWVLSFGVFAPLMFIGISIVRPLVLFPVSVISIAGGLAFGPLLGTLYTLFGSMCASAVSFFAAGLFSAKKNGHYERLEAIQKQMEDNGFFYIFLLRILPINFDFVSYAAGLSNVKALPYFAATAVGIIPGTIALNVLGASFLAGNLPAFFMVLALYIVFISLPFIFRKKMQNLFQESN